PDB entry 7kke

View 7kke on RCSB PDB site
Description: Phosphoinositide 3-Kinase gamma bound to a thiazole inhibitor
Class: TRANSFERASE/Inhibitor
Keywords: KINASE, INHIBITOR, TRANSFERASE-Inhibitor complex
Deposited on 2020-10-27, released 2021-03-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-24, with a file datestamp of 2021-03-19.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48736 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d7kkea1, d7kkea2, d7kkea3, d7kkea4, d7kkea5
  • Heterogens: WJV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7kkeA (A:)
    mpmaseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamh
    pwvtskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslm
    dipesqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevr
    keewplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdl
    tvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkap
    alsskasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfna
    dkltsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaii
    atdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdq
    saldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalar
    fllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvi
    emlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaie
    kckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetes
    ldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkeksptee
    kfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflgin
    kervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgm
    pqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgek
    hsalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7kkeA (A:)
    aseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmaeqdfvlrvc
    grdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrketvslwdcdrkfrvk
    irgidipvtdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgal
    lnlqiycvqllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatnpdkensmsis
    illdnpialpkempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfs
    svkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledd
    dvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfa
    vileaylrgcgtamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenl
    qnsqlpesfrvpydpglkagalaiekckvmaskkkplwlefkcadptnetigiifkhgdd
    lrqdmlilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvg
    ntgafkdevlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitet
    gnlfhidfghiervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnllii
    lfsmmlmtgmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflh
    lv