PDB entry 7jwz

View 7jwz on RCSB PDB site
Description: IPI-549 bound to the PI3Kg catalytic subunit p110 gamma
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: PI3K, inhibitor, phosphoinositides, p110, PIK3CG, TRANSFERASE, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2020-08-26, released 2021-03-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-17, with a file datestamp of 2021-03-12.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7jwza1, d7jwza2, d7jwza3, d7jwza4
  • Heterogens: V7Y

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7jwzA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >7jwzA (A:)
    seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
    skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmdfvlrvcgrde
    ylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkeecdrkfrvkirgidipvl
    tdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycv
    qllyyvnlllidhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnhpia
    empnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeiva
    ktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvq
    avkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcg
    tamlhdftqqvqviemlqkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrv
    pydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlil
    qilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvgntgafkde
    vlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidf
    ghervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtg
    mpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhl