PDB entry 7hvp

View 7hvp on RCSB PDB site
Description: x-ray crystallographic structure of a complex between a synthetic protease of human immunodeficiency virus 1 and a substrate-based hydroxyethylamine inhibitor
Deposited on 1990-09-13, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.146
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d7hvpa_
  • Chain 'B':
    Domains in SCOP 1.55: d7hvpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7hvpA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >7hvpA (A:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7hvpB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveixghkaigtvlvgptpvniigrnlltqigxtlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >7hvpB (B:)
    pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveighkaigtvlvgptpvniigrnlltqigtlnf