PDB entry 7fab

View 7fab on RCSB PDB site
Description: crystal structure of human immunoglobulin fragment fab new refined at 2.0 angstroms resolution
Deposited on 1991-11-20, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.169
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >7fabH (H:)
    avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
    pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
    

    Sequence, based on observed residues (ATOM records): (download)
    >7fabH (H:)
    avqleqsgpglvrpsqtlsltctvsgtsfddyywtwvrqppgrglewigyvfytgttlld
    pslrgrvtmlvntsknqfslrlssvtaadtavyycarnliaggidvwgqgslvtvssast
    kgpsvfplaptaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtv
    pssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7fabL (L:)
    asvltqppsvsgapgqrvtisctgsssnigaghnvkwyqqlpgtapkllifhnnarfsvs
    ksgtsatlaitglqaedeadyycqsydrslrvfgggtkltvlrqpkaapsvtlfppssee
    lqankatlvclisdfypgavtvawkadgspvkagvetttpskqsnnkyaassylsltpeq
    wkshksyscqvthegstvektvap