PDB entry 7cqc

View 7cqc on RCSB PDB site
Description: The NZ-1 Fab complexed with the PDZ tandem fragment of A. aeolicus S2P homolog with the PA14 tag inserted between the residues 181 and 184
Class: hydrolase/immune system
Keywords: soluble domain, Fab complex, Membrane protein, HYDROLASE-IMMUNE SYSTEM complex
Deposited on 2020-08-10, released 2021-05-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-05-19, with a file datestamp of 2021-05-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative zinc metalloprotease aq_1964,PA14 from Podoplanin,Putative zinc metalloprotease aq_1964
    Species: Aquifex aeolicus VF5 [TaxId:224324]
    Gene: aq_1964
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Heavy chain of antigen binding fragment, Fab of NZ-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 7CQC (0-218)
  • Chain 'L':
    Compound: Light chain of antigen binding fragment, Fab of NZ-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 7CQC (0-213)
    Domains in SCOPe 2.07: d7cqcl1, d7cqcl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7cqcL (L:)
    efvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhegrspttmiyrddkrpdgvp
    drfsgsidrssnsalltinnvqtedeadyfchsyssgivfgggtkltvlgqpkstptltv
    fppsteelqgnkatlvclisdfypsdvevawkangapisqgvdtanptkqgnkyiassfl
    rltaeqwrsrnsftcqvthegntvekslspaecv