PDB entry 7cel

View 7cel on RCSB PDB site
Description: cbh1 (e217q) in complex with cellohexaose and cellobiose
Deposited on 1997-09-24, released 1997-12-24
The last revision prior to the SCOP 1.55 freeze date was dated 1997-12-24, with a file datestamp of 1997-12-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d7cel__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7cel_ (-)
    esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
    cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
    tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
    kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
    dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
    nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
    vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
    ikfgpigstgnpsg