PDB entry 7c7j

View 7c7j on RCSB PDB site
Description: Crystal structure of SHANK3 SPN domain in complex with GTP-bound Rap1b(G12V,Q63E)
Class: protein binding
Keywords: SHANK3, Rap1b, SPN, Ras, PROTEIN BINDING
Deposited on 2020-05-25, released 2021-05-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ras-related protein Rap-1b
  Species: Homo sapiens [TaxId:9606]
  Gene: RAP1B, OK/SW-cl.11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61224 (0-166)
    • engineered mutation (11)
    • engineered mutation (62)
  Domains in SCOPe 2.08: d7c7ja_
• Chain 'B':
  Compound: Ras-related protein Rap-1b
  Species: Homo sapiens [TaxId:9606]
  Gene: RAP1B, OK/SW-cl.11
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61224 (0-166)
    • engineered mutation (11)
    • engineered mutation (62)
  Domains in SCOPe 2.08: d7c7jb_
• Chain 'C':
  Compound: SH3 and multiple ankyrin repeat domains protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: SHANK3, KIAA1650, PROSAP2, PSAP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BYB0
• Chain 'D':
  Compound: SH3 and multiple ankyrin repeat domains protein 3
  Species: Homo sapiens [TaxId:9606]
  Gene: SHANK3, KIAA1650, PROSAP2, PSAP2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9BYB0
• Heterogens: GTP, MG, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7c7jA (A:)
  mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
  teeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
  edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >7c7jB (B:)
  mreyklvvlgsvgvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
  teeftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
  edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.