PDB entry 7bv4

View 7bv4 on RCSB PDB site
Description: Crystal structure of STX17 LIR region in complex with GABARAP
Class: signaling protein
Keywords: Autophagy, Synatxin 17, GABARAP, SIGNALING PROTEIN
Deposited on 2020-04-09, released 2020-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7bv4a_
  • Chain 'B':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7bv4b_
  • Chain 'C':
    Compound: Syntaxin-17
    Species: Homo sapiens [TaxId:9606]
    Gene: STX17
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Syntaxin-17
    Species: Homo sapiens [TaxId:9606]
    Gene: STX17
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7bv4e_
  • Chain 'F':
    Compound: Syntaxin-17
    Species: Homo sapiens [TaxId:9606]
    Gene: STX17
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Gamma-aminobutyric acid receptor-associated protein
    Species: Homo sapiens [TaxId:9606]
    Gene: GABARAP, FLC3B, HT004
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d7bv4g_
  • Chain 'H':
    Compound: Syntaxin-17
    Species: Homo sapiens [TaxId:9606]
    Gene: STX17
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bv4A (A:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bv4A (A:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7bv4B (B:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bv4B (B:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysde
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7bv4E (E:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7bv4G (G:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl
    

  • Chain 'H':
    No sequence available.