PDB entry 7bfl

View 7bfl on RCSB PDB site
Description: X-ray structure of SS-RNase-2 des116-120
Class: hydrolase
Keywords: RNase, deletion mutant, Salmo salar, ancient ribonuclease, HYDROLASE
Deposited on 2021-01-04, released 2021-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiogenin-1
    Species: Salmo salar [TaxId:8030]
    Gene: ANG1, ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bfla_
  • Chain 'B':
    Compound: Angiogenin-1
    Species: Salmo salar [TaxId:8030]
    Gene: ANG1, ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bflb_
  • Chain 'C':
    Compound: Angiogenin-1
    Species: Salmo salar [TaxId:8030]
    Gene: ANG1, ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bflc_
  • Chain 'D':
    Compound: Angiogenin-1
    Species: Salmo salar [TaxId:8030]
    Gene: ANG1, ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bfld_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bflA (A:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgitd
    gk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bflA (A:)
    dvnqqynhflkqhvdgemttlkcksqmeilnlncklkntfilanpdqvqaictgggtlkg
    nnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgitd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7bflB (B:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgitd
    gk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bflB (B:)
    qqynhflkqhvdgemttlkcksqmeilncklkntfilanpdqvqaictgggtlkgnnlvq
    snkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgitd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7bflC (C:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgitd
    gk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bflC (C:)
    nqqynhflkqhvdgemttlkcksqmeilcklkntfilanpdqvqaictgggtlkgnnlvq
    snkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7bflD (D:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgitd
    gk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bflD (D:)
    nqqynhflkqhvdgemttlkcksqmeilnlrkcklkntfilanpdqvqaictgggtlkgn
    nlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgi