PDB entry 7bfk

View 7bfk on RCSB PDB site
Description: X-ray structure of SS-RNase-2
Class: hydrolase
Keywords: RNase, auto-inhibition, Salmo salar, ancient ribonuclease, HYDROLASE
Deposited on 2021-01-04, released 2021-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-05, with a file datestamp of 2021-04-30.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Angiogenin-1
    Species: Salmo salar [TaxId:8030]
    Gene: ANG1, ang1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5XAZ0 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d7bfka_
  • Chain 'B':
    Compound: Angiogenin-1
    Species: Salmo salar [TaxId:8030]
    Gene: ANG1, ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7bfkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7bfkA (A:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgdvd
    igitdgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bfkA (A:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgdvd
    igitd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7bfkB (B:)
    mdvnqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictg
    ggtlkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgdvd
    igitdgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >7bfkB (B:)
    nqqynhflkqhvdgemttlkcksqmeilnlnrpdrkcklkntfilanpdqvqaictgggt
    lkgnnlvqsnkpfsvvicthtggeshpnctykgssatkkviiacdgkfpvhydgdvdigi
    t