PDB entry 7a6o

View 7a6o on RCSB PDB site
Description: Crystal Structure of the Complex of the Recombinant Von Willebrand Factor AIM-A1 domain and VHH81 at 2.1 Angstrom resolution
Class: blood clotting
Keywords: Thrombosis Von Willebrand Factor A1 Aim-A1 Blood Clotting Complex VWF, BLOOD CLOTTING
Deposited on 2020-08-25, released 2021-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-28, with a file datestamp of 2021-07-23.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene: VWF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7a6oa_
  • Chain 'B':
    Compound: VHH81 Nanobody fragment
    Species: Lama glama [TaxId:9844]
    Gene: VHH
    Database cross-references and differences (RAF-indexed):
    • PDB 7A6O (0-127)
    Domains in SCOPe 2.08: d7a6ob_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7a6oA (A:)
isepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavvey
hdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasria
lllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvls
svdeleqqrdeivsylcdlapeapp

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7a6oB (B:)
evqlvesggglvqpggslrlscaasgrtfsynpmgwfrqapgkgrelvaaisrtggstyy
pdsvegrftisrdnakrmvylqmnslraedtavyycaaagvraedgrvrtlpseytfwgq
gtqvtvss