PDB entry 7a4m

View 7a4m on RCSB PDB site
Description: Cryo-EM structure of mouse heavy-chain apoferritin at 1.22 A
Class: metal binding protein
Keywords: Iron storage, metal binding protein
Deposited on 2020-08-20, released 2020-10-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: EM
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene: Fth1, Fth
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d7a4ma_
  • Heterogens: FE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7a4mA (A:)
psqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheere
haeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatdk
ndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg