PDB entry 7a1x

View 7a1x on RCSB PDB site
Description: KRASG12C GDP form in complex with Cpd1
Class: oncoprotein
Keywords: inhibitor, mutant, ONCOPROTEIN
Deposited on 2020-08-14, released 2021-10-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2022-01-12, with a file datestamp of 2022-01-07.
Experiment type: XRAY
Resolution: 1.32 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-164)
      • expression tag (0)
      • engineered mutation (12)
      • conflict (151)
      • conflict (153)
      • expression tag (165-169)
    Domains in SCOPe 2.08: d7a1xa1, d7a1xa2, d7a1xa3
  • Heterogens: QWB, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >7a1xA (A:)
    gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
    gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
    lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek