PDB entry 6zm8

View 6zm8 on RCSB PDB site
Description: Structure of muramidase from Acremonium alcalophilum
Class: hydrolase
Keywords: muramidase, fungal, GH25, lysozyme, industrial application, peptidoglycan cleavage, HYDROLASE
Deposited on 2020-07-01, released 2021-07-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-07-14, with a file datestamp of 2021-07-09.
Experiment type: XRAY
Resolution: 0.78 Å
R-factor: N/A
AEROSPACI score: 1.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muramidase
    Species: Sodiomyces alcalophilus [TaxId:398408]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ZM8 (0-207)
    Domains in SCOPe 2.08: d6zm8a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6zm8A (A:)
ripgfdisgwqpttdfarayangdrfvyikategttfkssafsrqytgatqngfirgayh
faqpaassgaaqaryfasngggwskdgitlpgaldieynpngatcyglsqsamvnwiedf
vttyhgitsrwpviytttdwwtqctgnsnrfanrcplwiaryassvgtlpngwgfytfwq
yndkypqggdsnwfngdasrlralangd