PDB entry 6yil

View 6yil on RCSB PDB site
Description: Crystal structure of the CREBBP bromodomain in complex with a tetrahydroquinoxaline ligand
Class: transcription
Keywords: Bromodomain, CREBBP, small molecule, benzo-diazepine, SGC, Structural Genomics Consortium, TRANSCRIPTION
Deposited on 2020-04-01, released 2020-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-15, with a file datestamp of 2020-04-10.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: crebbp
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6yila_
  • Heterogens: OSQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6yilA (A:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >6yilA (A:)
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg