PDB entry 6ye5

View 6ye5 on RCSB PDB site
Description: Structure of ribosomal binding factor A RbfA of Staphylococcus aureus bacterium by NMR
Class: structural protein
Keywords: Protein synthesis, heterologous protein expression, spatial structure of protein, Staphylococcus aureus, protein chromatography, STRUCTURAL PROTEIN
Deposited on 2020-03-24, released 2021-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome-binding factor a
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: rbfA, BN1321_240118, BTN44_06340, C7P97_08595, CSC83_12510, CSC87_08335, E3A28_02265, EP54_08770, EQ90_07890, ERS072840_01353, FQP72_08125, FVP29_01140, M1K003_0111, NCTC10654_01314, NCTC5664_02210, NCTC7878_01827, NCTC7988_01282, RK64_06775
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8UYA0 (1-115)
      • expression tag (0)
      • expression tag (116-117)
    Domains in SCOPe 2.08: d6ye5a1, d6ye5a2, d6ye5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6ye5A (A:)
gssmraervgeqmkkelmdiinnkvkdprvgfititdvvltndlsqakvfltvlgndkev
entfkaldkakgfikselgsrmrlrimpelmyeydqsieygnkiermiqdlhkqdrve