PDB entry 6xru

View 6xru on RCSB PDB site
Description: GTP-specific succinyl-CoA synthetase complexed with desulfo-coenzyme A, magnesium ions and succinates
Class: ligase
Keywords: Complex, LIGASE
Deposited on 2020-07-13, released 2021-03-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O19069 (0-304)
      • expression tag (305-308)
    Domains in SCOPe 2.07: d6xrua1, d6xrua2, d6xrua3
  • Chain 'B':
    Compound: Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6xrub1, d6xrub2
  • Heterogens: DCA, SIN, GOL, EDO, PO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xruA (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkmllvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xruA (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkmllvhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6xruB (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xruB (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvt