PDB entry 6xmj

View 6xmj on RCSB PDB site
Description: Human 20S proteasome bound to an engineered 11S (PA26) activator
Class: hydrolase
Keywords: 11S-bound, 20S proteasome, HYDROLASE
Deposited on 2020-06-30, released 2020-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proteasome subunit alpha type-6
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA6, PROS27
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmja_
  • Chain 'B':
    Compound: Proteasome subunit alpha type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA2, HC3, PSC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjb_
  • Chain 'C':
    Compound: Proteasome subunit alpha type-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA4, HC9, PSC9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjc_
  • Chain 'D':
    Compound: Proteasome subunit alpha type-7
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA7, HSPC
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Proteasome subunit alpha type-5
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmje_
  • Chain 'F':
    Compound: Proteasome subunit alpha type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA1, HC2, NU, PROS30, PSC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjf_
  • Chain 'G':
    Compound: Proteasome subunit alpha type-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMA3, HC8, PSC8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjg_
  • Chain 'H':
    Compound: Proteasome subunit beta type-6
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB6, LMPY, Y
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjh_
  • Chain 'I':
    Compound: Proteasome subunit beta type-7
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB7, Z
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmji_
  • Chain 'J':
    Compound: Proteasome subunit beta type-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjj_
  • Chain 'K':
    Compound: Proteasome subunit beta type-2
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjk_
  • Chain 'L':
    Compound: Proteasome subunit beta type-5
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB5, LMPX, MB1, X
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjl_
  • Chain 'M':
    Compound: Proteasome subunit beta type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB1, PSC5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjm_
  • Chain 'N':
    Compound: Proteasome subunit beta type-4
    Species: Homo sapiens [TaxId:9606]
    Gene: PSMB4, PROS26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6xmjn_
  • Chain 'O':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-227)
    Domains in SCOPe 2.07: d6xmjo1, d6xmjo2
  • Chain 'P':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-227)
    Domains in SCOPe 2.07: d6xmjp1, d6xmjp2
  • Chain 'Q':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-224)
    Domains in SCOPe 2.07: d6xmjq1, d6xmjq2
  • Chain 'R':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-227)
    Domains in SCOPe 2.07: d6xmjr1, d6xmjr2
  • Chain 'S':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-227)
    Domains in SCOPe 2.07: d6xmjs1, d6xmjs2
  • Chain 'T':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-227)
    Domains in SCOPe 2.07: d6xmjt1, d6xmjt2
  • Chain 'U':
    Compound: proteasome activator protein PA26
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U8G2 (0-222)
      • engineered mutation (45)
      • engineered mutation (98)
      • engineered mutation (222)
      • expression tag (223-227)
    Domains in SCOPe 2.07: d6xmju1, d6xmju2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6xmjA (A:)
    srgssagfdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdkll
    dsstvthlfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadi
    sqvytqnaemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflek
    kvkkkfdwtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlva
    laer
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjA (A:)
    fdrhitifspegrlyqveyafkainqggltsvavrgkdcavivtqkkvpdklldsstvth
    lfkitenigcvmtgmtadsrsqvqraryeaanwkykygyeipvdmlckriadisqvytqn
    aemrplgccmiligideeqgpqvykcdpagyycgfkataagvkqtestsflekkvkkkfd
    wtfeqtvetaitclstvlsidfkpseievgvvtvenpkfrilteaeidahlvalaer
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6xmjB (B:)
    aergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
    vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
    tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
    leledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjB (B:)
    fslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilydersvhkvep
    itkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqeytqsggv
    rpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekrynedleleda
    ihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6xmjC (C:)
    srrydsrttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevff
    sekiyklnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqay
    tqfggkrpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdyke
    gemtlksalalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkhe
    eeeakaerek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjC (C:)
    rttifspegrlyqveyameaighagtclgilandgvllaaerrnihklldevffsekiyk
    lnedmacsvagitsdanvltnelrliaqryllqyqepipceqlvtalcdikqaytqfggk
    rpfgvsllyigwdkhygfqlyqsdpsgnyggwkatcignnsaaavsmlkqdykegemtlk
    salalaikvlnktmdvsklsaekveiatltrengktvirvlkqkeveqlikkheeeeaka
    erek
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6xmjE (E:)
    ydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssieki
    veidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfgeed
    adpgamsrpfgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhk
    smtlkeaikssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjE (E:)
    ydrgvntfspegrlfqveyaieaiklgstaigiqtsegvclavekritsplmepssieki
    veidahigcamsgliadaktlidkarvetqnhwftynetmtvesvtqavsnlalqfmsrp
    fgvallfggvdekgpqlfhmdpsgtfvqcdaraigsasegaqsslqevyhksmtlkeaik
    ssliilkqvmeeklnatnielatvqpgqnfhmftkeeleevikdi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjF (F:)
    nqydndvtvwspqgrihqieyameavkqgsatvglkskthavlvalkraqselaahqkki
    lhvdnhigisiagltadarllcnfmrqecldsrfvfdrplpvsrlvsligsktqiptqry
    grrpygvglliagyddmgphifqtcpsanyfdcramsigarsqsartylerhmsefmecn
    lnelvkhglralretlpaeqdlttknvsigivgkdleftiyddddvspflegleerpq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6xmjG (G:)
    ssigtgydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyee
    gsnkrlfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvh
    aytlysavrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklq
    mkemtcrdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyak
    eslke
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjG (G:)
    gydlsastfspdgrvfqveyamkavensstaigirckdgvvfgveklvlsklyeegsnkr
    lfnvdrhvgmavaglladarsladiareeasnfrsnfgyniplkhladrvamyvhaytly
    savrpfgcsfmlgsysvndgaqlymidpsgvsygywgcaigkarqaakteieklqmkemt
    crdivkevakiiyivhdevkdkafelelswvgeltngrheivpkdireeaekyakeslke
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjH (H:)
    ttimavqfdggvvlgadsrtttgsyianrvtdkltpihdrifccrsgsaadtqavadavt
    yqlgfhsielnepplvhtaaslfkemcyryredlmagiiiagwdpqeggqvysvpmggmm
    vrqsfaiggsgssyiygyvdatyregmtkeeclqftanalalamerdgssggvirlaaia
    esgverqvllgdqipkfavatl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjI (I:)
    ttiagvvykdgivlgadtrategmvvadkncskihfispniyccgagtaadtdmttqlis
    snlelhslstgrlprvvtanrmlkqmlfryqgyigaalvlggvdvtgphlysiyphgstd
    klpyvtmgsgslaamavfedkfrpdmeeeeaknlvseaiaagifndlgsgsnidlcvisk
    nkldflrpytvpnkkgtrlgryrcekgttavltekitple
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjJ (J:)
    simsynggavmamkgkncvaiaadrrfgiqaqmvttdfqkifpmgdrlyiglaglatdvq
    tvaqrlkfrlnlyelkegrqikpytlmsmvanllyekrfgpyytepviagldpktfkpfi
    csldligcpmvtddfvvsgtcaeqmygmceslwepnmdpdhlfetisqamlnavdrdavs
    gmgvivhiiekdkittrtlkarmd
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjK (K:)
    meyligiqgpdyvlvasdrvaasnivqmkddhdkmfkmsekilllcvgeagdtvqfaeyi
    qknvqlykmrngyelsptaaanftrrnladclrsrtpyhvnlllagydehegpalyymdy
    laalakapfaahgygafltlsildryytptisreravellrkcleelqkrfilnlptfsv
    riidkngihdldnisfpkq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjL (L:)
    tttlafkfrhgvivaadsratagayiasqtvkkvieinpyllgtmaggaadcsfwerlla
    rqcriyelrnkerisvaaaskllanmvyqykgmglsmgtmicgwdkrgpglyyvdsegnr
    isgatfsvgsgsvyaygvmdrgysydleveqaydlarraiyqatyrdaysggavnlyhvr
    edgwirvssdnvadlhekysg
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjM (M:)
    rfspyvfnggtilaiagedfaivasdtrlsegfsihtrdspkcykltdktvigcsgfhgd
    cltltkiiearlkmykhsnnkamttgaiaamlstilysrrffpyyvyniiggldeegkga
    vysfdpvgsyqrdsfkaggsasamlqplldnqvgfknmqnvehvplsldramrlvkdvfi
    saaerdvytgdalricivtkegireetvslrkd
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6xmjN (N:)
    tqnpmvtgtsvlgvkfeggvviaadmlgsygslarfrnisrimrvnnstmlgasgdyadf
    qylkqvlgqmvideellgdghsyspraihswltramysrrskmnplwntmviggyadges
    flgyvdmlgvayeapslatgygaylaqpllrevlekqpvlsqteardlvercmrvlyyrd
    arsynrfqiatvtekgveiegplstetnwdiahmisg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6xmjO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjO (O:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnlsyyt
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >6xmjP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjP (P:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnlsyyt
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >6xmjQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjQ (Q:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnls
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >6xmjR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjR (R:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnlsyyt
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6xmjS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjS (S:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnlsyyt
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6xmjT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjT (T:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnlsyyt
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6xmjU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
    rqidadfmlkvelatthlstmvravinayllnwkkliqprtgnlsyyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6xmjU (U:)
    kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
    peqllgvlqryqdlchnvycqaetirtviairipehkeadnlgvavqhavlkiideleik
    tlgspigmyalreylsarstvedkllgggsqspslllelrqidadfmlkvelatthlstm
    vravinayllnwkkliqprtgnlsyyt