PDB entry 6wrk

View 6wrk on RCSB PDB site
Description: Crystal structure of 3rd-generation Mj 3-nitro-tyrosine tRNA synthetase ("A7") bound to 3-nitro-tyrosine
Class: ligase
Keywords: aminoacyl-tRNA synthetase, 3-nitro-tyrosine, LIGASE
Deposited on 2020-04-29, released 2020-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-01, with a file datestamp of 2020-06-26.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine--tRNA ligase
    Species: Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) [TaxId:243232]
    Gene: tyrS, MJ0389
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57834 (0-305)
      • engineered mutation (31)
      • engineered mutation (69)
      • engineered mutation (157-158)
      • engineered mutation (161)
      • expression tag (306-310)
    Domains in SCOPe 2.07: d6wrka1, d6wrka2
  • Heterogens: NIY, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6wrkA (A:)
    mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
    diiilladltaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnhahyrgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6wrkA (A:)
    mdefemikrntseiiseeelrevlkkdeksahigfepsgkihlghylqikkmidlqnagf
    diiilladltaylnqkgeldeirkigdynkkvfeamglkakyvygsefqldkdytlnvyr
    lalkttlkrarrsmeliaredenpkvaeviypimqvnhahyrgvdvavggmeqrkihmla
    rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
    imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
    pirkrllehhh