PDB entry 6w12

View 6w12 on RCSB PDB site
Description: Crystal Structure of the Carbohydrate Recognition Domain of the Human Macrophage Galactose C-Type Lectin Bound to the Tumor-Associated Tn Antigen
Class: signaling protein
Keywords: crd, signaling protein
Deposited on 2020-03-03, released 2021-03-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-19, with a file datestamp of 2021-05-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 10 member A
    Species: Homo sapiens [TaxId:9606]
    Gene: CLEC10A, CLECSF13, CLECSF14, HML
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IUN9 (1-128)
      • expression tag (0)
    Domains in SCOPe 2.08: d6w12a1, d6w12a2
  • Heterogens: CA, CL, ZN, SER, A2G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6w12A (A:)
    scpvnwvehqdscywfshsgmswaeaekycqlknahlvvinsreeqnfvqkylgsaytwm
    glsdpegawkwvdgtdyatgfqnwkpgqpddwqghglgggedcahfhpdgrwnddvcqrp
    yhwvceagl