PDB entry 6vov

View 6vov on RCSB PDB site
Description: Crystal structure of Syk in complex with GS-9876
Class: immune system
Keywords: Spleen tyrosine kinase B-cell Syk, IMMUNE SYSTEM
Deposited on 2020-01-31, released 2020-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6vova_
  • Chain 'B':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6vovb_
  • Heterogens: R6D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6vovA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vovA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkpalkdellaeanvmqql
    dnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylee
    snfvhrdlaarnvllvtqhyakisdfglskalradenyykaqwpvkwyapecinyykfss
    ksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwty
    dvenrpgfaavelrlrny
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6vovB (B:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
    vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
    kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
    cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
    dlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vovB (B:)
    yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkalkdellaeanvmqqldn
    pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
    fvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykf
    ssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcw
    tydvenrpgfaavelrlrnyyydv