PDB entry 6vos

View 6vos on RCSB PDB site
Description: Crystal structure of macaque anti-HIV-1 antibody RM20J
Class: immune system
Keywords: HIV, antibody, non-human primates, IMMUNE SYSTEM
Deposited on 2020-01-31, released 2020-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-16, with a file datestamp of 2020-09-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: RM20J Fab heavy chain
    Species: MACACA MULATTA [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 6VOS (0-221)
  • Chain 'L':
    Compound: RM20J Fab light chain
    Species: MACACA MULATTA [TaxId:9544]
    Database cross-references and differences (RAF-indexed):
    • PDB 6VOS (0-213)
    Domains in SCOPe 2.07: d6vosl1, d6vosl2
  • Heterogens: TAM, 2PE, P6G, PE8, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6vosL (L:)
divmtqspsslsasvgdtvtitcrasqditndlawyqqkpgkapkaliyyasnlesgvps
rfsgsgagtdftltisslqpedfalyycqqhnnypltfgpgtkvdikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec