PDB entry 6vcd

View 6vcd on RCSB PDB site
Description: Cryo-EM structure of IRP2-FBXL5-SKP1 complex
Class: ligase
Keywords: E3 ligase, [2Fe-2S] cluster, Iron metabolism, LIGASE
Deposited on 2019-12-20, released 2020-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: EM
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-responsive element binding protein 2, isoform CRA_a
    Species: Homo sapiens [TaxId:9606]
    Gene: IREB2, hCG_38938
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: F-box/LRR-repeat protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: FBXL5, FBL4, FBL5, FLR1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6vcdc1, d6vcdc2
  • Heterogens: FES

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6vcdC (C:)
    mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
    wcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtc
    ktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vcdC (C:)
    psiklqssdgeifevdveiakqsvtiktmledlgdpvplpnvnaailkkviqwcthhkdi
    pvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfnikndf
    teeeeaqvrkenqwc