PDB entry 6vbi

View 6vbi on RCSB PDB site
Description: crystal structure of PDE5 in complex with a non-competitive inhibitor
Class: hydrolase/inhibitor
Keywords: PDE5, allosteric regulation, non-competitive inhibitors, HYDROLASE, HYDROLASE-INHIBITOR complex
Deposited on 2019-12-18, released 2021-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2021-01-20, with a file datestamp of 2021-01-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6vbia_
  • Chain 'B':
    Compound: cGMP-specific 3',5'-cyclic phosphodiesterase
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE5A, PDE5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6vbib_
  • Heterogens: FZA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6vbiA (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vbiA (A:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqa
    laeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6vbiB (B:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
    vsedcfplldgcrknrqkwqalaeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6vbiB (B:)
    eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
    lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
    ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
    iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
    qqriaelvateknkipsmqvgfidaiclqlyealthvsedcfplldgcrknrqkwqalae
    q