PDB entry 6utn

View 6utn on RCSB PDB site
Description: Native E. coli Glyceraldehyde 3-phosphate dehydrogenase
Class: cytosolic protein
Keywords: G3P, glyceraldehyde 3-phosphate dehydrogenase, E. coli, CYTOSOLIC PROTEIN
Deposited on 2019-10-29, released 2019-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: gapA, ACN002_1253
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6utna1, d6utna2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: gapA, ACN002_1253
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6utnb1, d6utnb2
  • Heterogens: MSE, G3P, TRE, ACT, NA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6utnA (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6utnB (B:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk