PDB entry 6utm

View 6utm on RCSB PDB site
Description: Native E. coli Glyceraldehyde 3-phosphate dehydrogenase
Class: cytosolic protein
Keywords: G3P, glyceraldehyde 3-phosphate dehydrogenase, E. coli, CYTOSOLIC PROTEIN
Deposited on 2019-10-29, released 2019-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-12-11, with a file datestamp of 2019-12-06.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: gapA, ACN002_1253
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6utma1, d6utma2
  • Chain 'B':
    Compound: glyceraldehyde-3-phosphate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: gapA, ACN002_1253
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6utmb1, d6utmb2
  • Heterogens: G3P, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6utmA (A:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6utmB (B:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk