PDB entry 6u8c

View 6u8c on RCSB PDB site
Description: Crystal structure of an engineered ultra-high affinity Fab-Protein G complex
Class: immune system
Keywords: engineered Fab, protein G, high affinity, IMMUNE SYSTEM
Deposited on 2019-09-04, released 2019-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • PDB 6U8C
    Domains in SCOPe 2.07: d6u8ca_
  • Chain 'B':
    Compound: protein g
    Species: Streptococcus sp. 'group G' [TaxId:1320]
    Gene: spg
    Database cross-references and differences (RAF-indexed):
    • PDB 6U8C
    Domains in SCOPe 2.07: d6u8cb_
  • Chain 'C':
    Compound: antibody light chain fab
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6U8C (Start-213)
    Domains in SCOPe 2.07: d6u8cc1, d6u8cc2
  • Chain 'D':
    Compound: antibody heavy chain fab
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6U8C
  • Chain 'H':
    Compound: antibody heavy chain fab
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6U8C
  • Chain 'L':
    Compound: antibody light chain fab
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6U8C (Start-213)
    Domains in SCOPe 2.07: d6u8cl1, d6u8cl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u8cA (A:)
    tpavttyklvingrtlsgyttttavdaataekvfkqyayvhevdgewtyddatktftvte
    kpeklgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u8cA (A:)
    vttyklvingrtlsgyttttavdaataekvfkqyayvhevdgewtyddatktftvte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6u8cB (B:)
    tpavttyklvingrtlsgyttttavdaataekvfkqyayvhevdgewtyddatktftvte
    kpeklgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u8cB (B:)
    avttyklvingrtlsgyttttavdaataekvfkqyayvhevdgewtyddatktftvte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6u8cC (C:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqasltalltfgqgtkveikrtvaapsvfif
    ppsdlrtgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u8cC (C:)
    spsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsgsr
    sgtdftltisslqpedfatyycqqalltfgqgtkveikrtvaapsvfifppsdlrtgtas
    vvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkv
    yacevthqglsspvtksfnrgec
    

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6u8cL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqasltalltfgqgtkveikrtvaapsvfif
    ppsdlrtgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u8cL (L:)
    tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrfsg
    gtdftltisslqpedfatyycqqalltfgqgtkveikrtvaapsvfifppsdlrtgtasv
    vcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvy
    acevthqglsspvtksfnrgec