PDB entry 6u69

View 6u69 on RCSB PDB site
Description: Crystal structure of Yck2 from Candida albicans, apoenzyme
Class: transferase
Keywords: casein kinase 1, Yck2, kinase, structural genomics, center for structural genomics of infectious diseases, niaid, national institute of allergy and infectious diseases, CSGID, TRANSFERASE
Deposited on 2019-08-29, released 2019-10-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine protein kinase
    Species: Candida albicans (strain SC5314 / ATCC MYA-2876) [TaxId:237561]
    Gene: YCK2, orf19.7001, CAALFM_C305650WA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u69a_
  • Heterogens: SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u69A (A:)
    ssvvglhykigkkigegsfgvifegtniingvpvaikfeprkteapqlrdeyrtykhlqg
    cdgipnayyfgqeglhnilvidllgpsledlfdwcgrrfsvktvvqvaiqmltlveevhr
    hdliyrdikpdnfligrrgatdennvhlidfgmakqyrdprtkqhipyrekkslsgtary
    msinthlgreqsrrddlealghvffyflrgqlpwqglkaptnkqkyekigdkkrttpavt
    lcdglpqqfaeyldsvrslpfdaeppyeeyrmlllsvlddlgqacdgdmdwmhlnggrgw
    datinkkpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u69A (A:)
    ssvvglhykigkkigegsfgvifegtniingvpvaikfeprkteapqlrdeyrtykhlqg
    cdgipnayyfgqeglhnilvidllgpsledlfdwcgrrfsvktvvqvaiqmltlveevhr
    hdliyrdikpdnfligrrgatdennvhlidfgmakqyrdprtkqhipyrekkslsgtary
    msinthlgreqsrrddlealghvffyflrgqlpwqglkaptnkqkyekigdkkrttpavt
    lcdglpqqfaeyldsvrslpfdaeppyeeyrmlllsvlddlgqacdgdmdwmhlnggrgw
    datink