PDB entry 6u57

View 6u57 on RCSB PDB site
Description: KDO8PS Structure Determined at the EuXFEL using Segmented Flow Injection
Class: transferase
Keywords: Catalytic Activity, Transferase Activity, TRANSFERASE
Deposited on 2019-08-27, released 2020-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-23, with a file datestamp of 2020-09-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydro-3-deoxyphosphooctonate aldolase
    Species: Escherichia coli (strain B / BL21-DE3) [TaxId:469008]
    Gene: kdsA, ECBD_2406
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6u57a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u57A (A:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u57A (A:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcraqvaelaragmavglaglfieahpdpehakcdg
    psalplaklepflkqmkaiddlvkgfeeldtsk