PDB entry 6u2x

View 6u2x on RCSB PDB site
Description: Structure of ALDH7A1 mutant E399G complexed with NAD
Class: oxidoreductase
Keywords: aldehyde dehydrogenase, nad, oxidoreductase, lysine catabolism
Deposited on 2019-08-20, released 2019-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xa_
  • Chain 'B':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xb_
  • Chain 'C':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xc_
  • Chain 'D':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xd_
  • Chain 'E':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xe_
  • Chain 'F':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xf_
  • Chain 'G':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xg_
  • Chain 'H':
    Compound: Alpha-aminoadipic semialdehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH7A1, ATQ1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49419 (Start-512)
      • engineered mutation (400)
    Domains in SCOPe 2.07: d6u2xh_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6u2xA (A:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xA (A:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6u2xB (B:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xB (B:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6u2xC (C:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xC (C:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6u2xD (D:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xD (D:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6u2xE (E:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xE (E:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6u2xF (F:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xF (F:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6u2xG (G:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xG (G:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6u2xH (H:)
    ghmstllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasva
    dyeetvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvge
    vqeyvdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnna
    iamicgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakder
    vnllsftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgta
    gqrcttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgave
    eakkeggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfa
    wnnevkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggr
    esgsdawkqymrrstctinyskdlplaqgikfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6u2xH (H:)
    tllinqpqyawlkelglreenegvyngswggrgevittycpannepiarvrqasvadyee
    tvkkareawkiwadipapkrgeivrqigdalrekiqvlgslvslemgkilvegvgevqey
    vdicdyavglsrmiggpilpsersghalieqwnpvglvgiitafnfpvavygwnnaiami
    cgnvclwkgapttslisvavtkiiakvlednklpgaicsltcggadigtamakdervnll
    sftgstqvgkqvglmvqerfgrsllelggnnaiiafedadlslvvpsalfaavgtagqrc
    ttarrlfihesihdevvnrlkkayaqirvgnpwdpnvlygplhtkqavsmflgaveeakk
    eggtvvyggkvmdrpgnyveptivtglghdasiahtgtfapilyvfkfkneeevfawnne
    vkqglsssiftkdlgrifrwlgpkgsdcgivnvniptsgaeiggafggekhtgggresgs
    dawkqymrrstctinyskdlplaqgikfq