PDB entry 6tj9

View 6tj9 on RCSB PDB site
Description: Escherichia coli transketolase in complex with cofactor analog 2'-methoxythiamine and substrate xylulose 5-phosphate
Class: transferase
Keywords: thiamin diphosphate, enzyme catalysis, pentose phosphate pathway, transferase
Deposited on 2019-11-25, released 2020-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transketolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tktA, tkt, b2935, JW5478
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663-664)
    Domains in SCOPe 2.07: d6tj9a1, d6tj9a2, d6tj9a3, d6tj9a4
  • Chain 'B':
    Compound: Transketolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: tktA, tkt, b2935, JW5478
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27302 (Start-662)
      • expression tag (663-667)
    Domains in SCOPe 2.07: d6tj9b1, d6tj9b2, d6tj9b3, d6tj9b4
  • Heterogens: NDQ, 5SP, CA, EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6tj9A (A:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tj9A (A:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6tj9B (B:)
    mssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrf
    vlsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgi
    anavgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgklia
    fyddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsl
    lmcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeag
    qakesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrka
    sqnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiang
    islhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqva
    slrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniargg
    yvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresv
    lpkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakak
    ellhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tj9B (B:)
    ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
    lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
    navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
    yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
    mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
    akesawnekfaayakaypqeaaeftrrmkgempsdfdakakefiaklqanpakiasrkas
    qnaieafgpllpeflggsadlapsnltlwsgskainedaagnyihygvrefgmtaiangi
    slhggflpytstflmfveyarnavrmaalmkqrqvmvythdsiglgedgpthqpveqvas
    lrvtpnmstwrpcdqvesavawkygverqdgptalilsrqnlaqqerteeqlaniarggy
    vlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstdafdkqdaayresvl
    pkavtarvaveagiadywykyvglngaivgmttfgesapaellfeefgftvdnvvakake
    llhhhhh