PDB entry 6tan

View 6tan on RCSB PDB site
Description: x-ray structure of human k-ras g12c in complex with covalent isoquinolinone inhibitor (compound 17)
Class: hydrolase
Keywords: kras, inhibitor, covalent binding, hydrolase
Deposited on 2019-10-30, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-06-03, with a file datestamp of 2020-05-29.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: N/A
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
      • engineered mutation (51)
      • engineered mutation (80)
      • engineered mutation (118)
    Domains in SCOPe 2.08: d6tana1, d6tana2
  • Heterogens: MZN, GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6tanA (A:)
gmteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildta
gqeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek