PDB entry 6taa

View 6taa on RCSB PDB site
Description: structure and molecular model refinement of aspergillus oryzae (taka) alpha-amylase: an application of the simulated-annealing method
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1992-08-21, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d6taaa1, d6taaa2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6taaA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskicsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6taaA (A:)
    atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
    witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
    nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
    dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
    pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
    fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
    liasanairnyaiskdtgfvtyknwpiykddttiamrkgtdgsqivtilsnkgasgdsyt
    lslsgagytagqqltevigcttvtvgsdgnvpvpmagglprvlypteklagskics