PDB entry 6t6c

View 6t6c on RCSB PDB site
Description: Complex with chitin oligomer of C-type lysozyme from the upper gastrointestinal tract of Opisthocomus hoatzin
Class: hydrolase
Keywords: C-type lysoyme, glycoside hydrolase, HYDROLASE
Deposited on 2019-10-18, released 2019-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: N/A
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Opisthocomus hoazin [TaxId:30419]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91159 (Start-127)
      • insertion (1-2)
      • engineered mutation (36)
    Domains in SCOPe 2.08: d6t6ca_
  • Heterogens: NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6t6cA (A:)
ekriiprcelvkilrehgfegfegttiadwiclvqhasdynteaynnngpsrdygifqin
skywcndgktsgavdgchiscselmtndleddikcakkiardahgltpwygwknhcegrd
lssyvkgc