PDB entry 6t5s

View 6t5s on RCSB PDB site
Description: Apo form of C-type lysozyme from the upper gastrointestinal tract of Opisthocomus hoatzin
Class: hydrolase
Keywords: C-type lysoyme, glycoside hydrolase, HYDROLASE
Deposited on 2019-10-17, released 2019-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: Opisthocomus hoazin [TaxId:30419]
    Gene: LYZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6t5sa_
  • Heterogens: GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6t5sA (A:)
eiiprcelvkilrehgfegfegttiadwiclvqhesdynteaynnngpsrdygifqinsk
ywcndgktsgavdgchiscselmtndleddikcakkiardahgltpwygwknhcegrdls
syvkgc