PDB entry 6sw8

View 6sw8 on RCSB PDB site
Description: Crystal structure of the NS1 (H7N1) RNA-binding domain
Class: viral protein
Keywords: INFLUENZA VIRUS, RNA-BINDING DOMAIN, RNA BINDING PROTEIN, Viral protein
Deposited on 2019-09-20, released 2020-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza A virus (A/turkey/Italy/977/1999(H7N1)) [TaxId:437402]
    Gene: ns1, NS, NS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1PST0 (5-76)
      • expression tag (4)
    Domains in SCOPe 2.07: d6sw8a1, d6sw8a2
  • Chain 'B':
    Compound: Non-structural protein 1
    Species: Influenza A virus (A/turkey/Italy/977/1999(H7N1)) [TaxId:437402]
    Gene: ns1, NS, NS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1PST0 (5-76)
      • expression tag (4)
    Domains in SCOPe 2.07: d6sw8b1, d6sw8b2
  • Heterogens: EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sw8A (A:)
    gshmsdsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrv
    atmegkkivedilkset
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sw8A (A:)
    sdsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrvatme
    gkkivedilkset
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6sw8B (B:)
    gshmsdsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrv
    atmegkkivedilkset
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sw8B (B:)
    sdsntitsfqvdcylwhirkllsmrdmcdapfddrlrrdqkalkgrgstlgldlrvatme
    gkkivedilkset