PDB entry 6ssb

View 6ssb on RCSB PDB site
Description: syk in complex with compound 30
Class: transferase
Keywords: SYK Kinase TRANSFERASE INHIBITOR, TRANSFERASE
Deposited on 2019-09-06, released 2020-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-30, with a file datestamp of 2020-09-25.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: Homo sapiens [TaxId:9606]
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-292)
      • expression tag (293-295)
    Domains in SCOPe 2.07: d6ssba1, d6ssba2
  • Heterogens: LUE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ssbA (A:)
    mdtevyespyadpeeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavk
    ilkneandpalkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqq
    nrhvkdkniielvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalrad
    enyykaqthgkwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevt
    amlekgermgcpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvnhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ssbA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilklkdellaeanvmqqldn
    pyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesn
    fvhrdlaarnvllvtqhyakisdfglskalradenyykaqthkwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydvvnhhh