PDB entry 6sp9

View 6sp9 on RCSB PDB site
Description: Fragment KCL802 in complex with MAP kinase p38-alpha
Class: transferase
Keywords: FBDD, Fragment Based Drug Design, P38, MAPK14, Kinase, Transferase., TRANSFERASE
Deposited on 2019-08-31, released 2019-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47811
      • conflict (162)
    Domains in SCOPe 2.07: d6sp9a_
  • Heterogens: LOT, SB4, CA, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sp9A (A:)
    gmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpf
    qsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkc
    qkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfglarhtddem
    tgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlv
    gtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkrita
    aqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeeme
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sp9A (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltd
    dhvqfliyqilrglkyihsadiihrdlkpsnlavnedselkildfgarhtyvatrwyrap
    eimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkis
    sesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqy
    hdpddepvadpydqsfesrdllidewksltydevisfvpppldqeeme