PDB entry 6soi

View 6soi on RCSB PDB site
Description: Fragment N13788a in complex with MAP kinase p38-alpha
Class: transferase
Keywords: FBDD, Fragment Based Drug Design, P38, MAPK14, Kinase, Transferase., TRANSFERASE
Deposited on 2019-08-29, released 2019-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6soia_
  • Heterogens: LOK, CL, MG, SO4, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6soiA (A:)
    mgsshhhhhhsqdpenlyfqgmsqerptfyrqelnktiwevperyqnlspvgsgaygsvc
    aafdtktghrvavkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleef
    ndvylvthlmgadlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavn
    edcelkildfglarhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltg
    rtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganp
    lavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewks
    ltydevisfvpppldqeeme
    

    Sequence, based on observed residues (ATOM records): (download)
    >6soiA (A:)
    erptfyrqelnktiwevperyqnlspvgsygsvcaafdtktghrvavkklsrpfqsiiha
    krtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltdd
    hvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglahtddemtgyvatr
    wyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgael
    lkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalaha
    yfaqyhdpddepvadpydqsfesrdllidewksltydevisfvppp