PDB entry 6rxn

View 6rxn on RCSB PDB site
Description: the structure of rubredoxin from desulfovibrio desulfuricans
Deposited on 1990-01-16, released 1991-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-07-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.5 Å
R-factor: 0.093
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d6rxn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rxn_ (-)
    mqkyvcnvcgyeydpaehdnvpfdqlpddwccpvcgvskdqfspa