PDB entry 6rxb

View 6rxb on RCSB PDB site
Description: Crystal structure of TetR-Q116A from Acinetobacter baumannii AYE in complex with minocycline
Class: transcription
Keywords: Transcription regulation, TRANSCRIPTION
Deposited on 2019-06-07, released 2020-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tetracycline repressor protein class G
    Species: Acinetobacter baumannii (strain AYE) [TaxId:509173]
    Gene: tetR, ABAYE3639
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0VCI2
      • engineered mutation (115)
    Domains in SCOPe 2.07: d6rxba1, d6rxba2
  • Chain 'B':
    Compound: Tetracycline repressor protein class G
    Species: Acinetobacter baumannii (strain AYE) [TaxId:509173]
    Gene: tetR, ABAYE3639
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0VCI2 (Start-207)
      • engineered mutation (115)
      • expression tag (208-211)
    Domains in SCOPe 2.07: d6rxbb1, d6rxbb2, d6rxbb3
  • Chain 'C':
    Compound: Tetracycline repressor protein class G
    Species: Acinetobacter baumannii (strain AYE) [TaxId:509173]
    Gene: tetR, ABAYE3639
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0VCI2
      • engineered mutation (115)
    Domains in SCOPe 2.07: d6rxbc1, d6rxbc2
  • Chain 'D':
    Compound: Tetracycline repressor protein class G
    Species: Acinetobacter baumannii (strain AYE) [TaxId:509173]
    Gene: tetR, ABAYE3639
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0VCI2 (Start-207)
      • engineered mutation (115)
      • expression tag (208-212)
    Domains in SCOPe 2.07: d6rxbd1, d6rxbd2, d6rxbd3
  • Heterogens: MIY, MG, CL, SIN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6rxbA (A:)
    mtkldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeaml
    aerhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairfl
    caegfcpkravwalravshyvvgsvleqqasdadervpdrpdvseqapssflhdlfhele
    tdgmdaafnfgldsliagferlrssttdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rxbA (A:)
    kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae
    rhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairflca
    egfcpkravwalravshyvvgsvleqqasdadeetdgmdaafnfgldsliagferlrss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6rxbB (B:)
    mtkldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeaml
    aerhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairfl
    caegfcpkravwalravshyvvgsvleqqasdadervpdrpdvseqapssflhdlfhele
    tdgmdaafnfgldsliagferlrssttdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rxbB (B:)
    kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae
    rhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrpfgtaetairflcaegfc
    pkravwalravshyvvgsvleqqasdadedvseqapssflhdlfheletdgmdaafnfgl
    dsliagferlrssttdhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6rxbC (C:)
    mtkldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeaml
    aerhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairfl
    caegfcpkravwalravshyvvgsvleqqasdadervpdrpdvseqapssflhdlfhele
    tdgmdaafnfgldsliagferlrssttdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rxbC (C:)
    kldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlae
    rhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairflca
    egfcpkravwalravshyvvgsvleqqasdadetdgmdaafnfgldsliagferlrss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6rxbD (D:)
    mtkldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeaml
    aerhtrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairfl
    caegfcpkravwalravshyvvgsvleqqasdadervpdrpdvseqapssflhdlfhele
    tdgmdaafnfgldsliagferlrssttdhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6rxbD (D:)
    ldkgtviaaalellnevgmdslttrklaerlkvqqpalywhfqnkralldalaeamlaer
    htrslpeenedwrvflkenalsfrtallsyrdgarihagtrptepnfgtaetairflcae
    gfcpkravwalravshyvvgsvleqqasdadelhdlfhelmdaafnfgldsliagferlr
    ssttdhhhhh