PDB entry 6rly

View 6rly on RCSB PDB site
Description: Human MMP12 (catalytic domain) in complex with AP316
Class: hydrolase
Keywords: MMP12, inhibitors, catalytic domain, hydrolase
Deposited on 2019-05-03, released 2020-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-03-11, with a file datestamp of 2020-03-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d6rlya1, d6rlya2
  • Heterogens: K8T, ZN, CA, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rlyA (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg