PDB entry 6rd0

View 6rd0 on RCSB PDB site
Description: Human MMP12 catalytic domain in complex with AP280
Class: hydrolase
Keywords: MMP12, inhibitors, catalytic domain, HYDROLASE
Deposited on 2019-04-12, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • initiating methionine (0)
      • engineered mutation (66)
    Domains in SCOPe 2.08: d6rd0a1, d6rd0a2
  • Heterogens: ZN, CA, K0Q, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6rd0A (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg