PDB entry 6r3c

View 6r3c on RCSB PDB site
Description: Solution structure of birch pollen allergen Bet v 1a
Class: allergen
Keywords: Bet v 1, birch pollen allergen, ALLERGEN
Deposited on 2019-03-20, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6r3ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6r3cA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn