PDB entry 6qna

View 6qna on RCSB PDB site
Description: Structure of bovine anti-RSV hybrid Fab B13HC-B4LC
Class: immune system
Keywords: cattle antibodies, bovine respiratory syncytial virus, anti-RSV B4, anti-RSV B13, hybrid Fab, IMMUNE SYSTEM
Deposited on 2019-02-10, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B13 Heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
  • Chain 'B':
    Compound: B4 light chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
    Domains in SCOPe 2.07: d6qnab1, d6qnab2
  • Chain 'C':
    Compound: B13 Heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
  • Chain 'D':
    Compound: B4 light chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
    Domains in SCOPe 2.07: d6qnad1, d6qnad2
  • Chain 'E':
    Compound: B13 Heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
  • Chain 'F':
    Compound: B4 light chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
    Domains in SCOPe 2.07: d6qnaf1, d6qnaf2
  • Chain 'H':
    Compound: B13 Heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
  • Chain 'L':
    Compound: B4 light chain
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6QNA
    Domains in SCOPe 2.07: d6qnal1, d6qnal2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qnaB (B:)
    qavltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvp
    drfsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qnaB (B:)
    vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr
    fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlfpp
    steelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassylsl
    tssdwkskgsyscevthegstvtktvkpsec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6qnaD (D:)
    qavltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvp
    drfsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qnaD (D:)
    vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr
    fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlfpp
    steelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassylsl
    tssdwkskgsyscevthegstvtktvkpsec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6qnaF (F:)
    qavltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvp
    drfsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qnaF (F:)
    vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr
    fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlfpp
    steelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassylsl
    tssdwkskgsyscevthegstvtktvkpsec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6qnaL (L:)
    qavltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvp
    drfsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qnaL (L:)
    vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr
    fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlfpp
    steelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassylsl
    tssdwkskgsyscevthegstvtktvkpsec