PDB entry 6qn9

View 6qn9 on RCSB PDB site
Description: Structure of bovine anti-RSV Fab B4
Class: immune system
Keywords: cattle antibodies, bovine respiratory syncytial virus, anti-RSV B4, anti-RSV B13, hybrid Fab, immune system
Deposited on 2019-02-10, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: heavy chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 6QN9 (0-End)
  • Chain 'L':
    Compound: light chain
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 6QN9
    Domains in SCOPe 2.07: d6qn9l1, d6qn9l2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6qn9L (L:)
    qavltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvp
    drfsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qn9L (L:)
    vltqppsvsgslgqrvsitcsgsssnigrwgvnwyqqvpgsglrtiiyyessrpsgvpdr
    fsgsksgntatltisslqaedeadyfcatgdyniavfgsgttlivmgqpksppsvtlfpp
    steelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassylsl
    tssdwkskgsyscevthegstvtktvkpse