PDB entry 6qlb

View 6qlb on RCSB PDB site
Description: Calpain small subunit 1, RNA-binding protein Hfq
Class: DNA binding protein
Keywords: Calpain-1, PEF(S), Hfq, E.coli, Chaperone, Calcium binding, EF-Hand, Complex, 3D Structure Determination, Contamination, Contaminant, RNA binding, DNA binding, Cysteine, Protease, Nucleotide, DNA BINDING PROTEIN
Deposited on 2019-01-31, released 2020-02-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04632 (Start-172)
      • conflict (7)
      • conflict (10)
      • conflict (77)
      • conflict (80)
      • conflict (84)
      • conflict (94)
      • conflict (96)
      • conflict (111)
      • conflict (113)
      • conflict (115)
      • conflict (125)
      • conflict (148)
      • conflict (153)
    Domains in SCOPe 2.07: d6qlba_
  • Chain 'B':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04632 (0-172)
      • conflict (7)
      • conflict (10)
      • conflict (77)
      • conflict (80)
      • conflict (84)
      • conflict (94)
      • conflict (96)
      • conflict (111)
      • conflict (113)
      • conflict (115)
      • conflict (125)
      • conflict (148)
      • conflict (153)
    Domains in SCOPe 2.07: d6qlbb_
  • Chain 'C':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04632 (0-172)
      • conflict (7)
      • conflict (10)
      • conflict (77)
      • conflict (80)
      • conflict (84)
      • conflict (94)
      • conflict (96)
      • conflict (111)
      • conflict (113)
      • conflict (115)
      • conflict (125)
      • conflict (148)
      • conflict (153)
    Domains in SCOPe 2.07: d6qlbc_
  • Chain 'D':
    Compound: Calpain small subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CAPNS1, CAPN4, CAPNS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04632 (0-172)
      • conflict (7)
      • conflict (10)
      • conflict (77)
      • conflict (80)
      • conflict (84)
      • conflict (94)
      • conflict (96)
      • conflict (111)
      • conflict (113)
      • conflict (115)
      • conflict (125)
      • conflict (148)
      • conflict (153)
    Domains in SCOPe 2.07: d6qlbd_
  • Chain 'E':
    Compound: RNA-binding protein Hfq
    Species: Escherichia coli [TaxId:562]
    Gene: hfq, NCTC13125_02619
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qlbe1, d6qlbe2
  • Chain 'F':
    Compound: RNA-binding protein Hfq
    Species: Escherichia coli [TaxId:562]
    Gene: hfq, NCTC13125_02619
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qlbf1, d6qlbf2
  • Chain 'G':
    Compound: RNA-binding protein Hfq
    Species: Escherichia coli [TaxId:562]
    Gene: hfq, NCTC13125_02619
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qlbg1, d6qlbg2
  • Chain 'H':
    Compound: RNA-binding protein Hfq
    Species: Escherichia coli [TaxId:562]
    Gene: hfq, NCTC13125_02619
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6qlbh1, d6qlbh2
  • Heterogens: CA, GUN, EDO, P4G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qlbA (A:)
    eevrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
    rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qlbA (A:)
    evrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdtt
    gklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiirr
    ysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbB (B:)
    eevrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
    rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbC (C:)
    eevrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
    rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbD (D:)
    eevrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
    tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
    rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbE (E:)
    gqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbF (F:)
    gqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbG (G:)
    gqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6qlbH (H:)
    gqslqdpflnalrrervpvsiylvngiklqgqiesfdqfvillkntvsqmvykhaistvv
    psa