SCOPe 2.08: Structural Classification of Proteins

PDB entry 6qk9

View 6qk9 on RCSB PDB site
Description: A dimeric ubiquitin formed by a single amino acid substitution
Class: signaling protein
Keywords: Ubiquitin, dimerisation, dimer, SIGNALING PROTEIN
Deposited on 2019-01-28, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9a1, d6qk9a2
Chain 'B':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9b1, d6qk9b2
Chain 'C':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9c1, d6qk9c2
Chain 'D':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9d_
Chain 'E':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-78)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9e1, d6qk9e2
Chain 'F':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9f1, d6qk9f2
Chain 'G':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9g_
Chain 'H':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-78)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9h1, d6qk9h2
Chain 'I':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - expression tag (3-4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9i1, d6qk9i2
Chain 'J':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-78)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9j1, d6qk9j2
Chain 'K':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-78)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9k1, d6qk9k2
Chain 'L':
Compound: Polyubiquitin-B
Species: Homo sapiens [TaxId:9606]
Gene: UBB
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG47 (5-End)
  - expression tag (4)
  - engineered mutation (14)
Domains in SCOPe 2.08: d6qk9l1, d6qk9l2
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6qk9A (A:)
gsggsmqifvktltvktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrt
lsdyniqkestlhlvlrlr