PDB entry 6qap

View 6qap on RCSB PDB site
Description: Structure of the human aldehyde dehydrogenase 9A1 in C2 space group
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2018-12-19, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qapa1, d6qapa2
  • Chain 'B':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qapb1, d6qapb2
  • Chain 'C':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qapc1, d6qapc2
  • Chain 'D':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qapd1, d6qapd2
  • Heterogens: EDO, PEG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qapA (A:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qapA (A:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgkspliif
    sdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplled
    trmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrdd
    mtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcf
    innynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qapB (B:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qapB (B:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgkspliif
    sdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplled
    trmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrdd
    mtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcf
    innynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6qapC (C:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qapC (C:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6qapD (D:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qapD (D:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftggksplii
    fsdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplle
    dtrmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrd
    dmtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtc
    finnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf