PDB entry 6qao

View 6qao on RCSB PDB site
Description: Structure of human aldehyde dehydrogenase 9A1 in P21 space group
Class: oxidoreductase
Keywords: Aldehyde dehydrogenase, oxidoreductase
Deposited on 2018-12-19, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaoa1, d6qaoa2
  • Chain 'B':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaob1, d6qaob2
  • Chain 'C':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaoc1, d6qaoc2
  • Chain 'D':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaod1, d6qaod2
  • Chain 'E':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaoe1, d6qaoe2
  • Chain 'F':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaof1, d6qaof2
  • Chain 'G':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaog1, d6qaog2
  • Chain 'H':
    Compound: 4-trimethylaminobutyraldehyde dehydrogenase
    Species: Homo sapiens [TaxId:9606]
    Gene: ALDH9A1, ALDH4, ALDH7, ALDH9
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49189 (14-507)
      • expression tag (13)
    Domains in SCOPe 2.07: d6qaoh1, d6qaoh2
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6qaoA (A:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoA (A:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgkspliif
    sdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplled
    trmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrdd
    mtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcf
    innynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6qaoB (B:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoB (B:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftkspliifs
    dcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledt
    rmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddm
    tcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcfi
    nnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6qaoC (C:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoC (C:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftgkspliif
    sdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplled
    trmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrdd
    mtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcf
    innynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6qaoD (D:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoD (D:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsfkspliifsd
    cdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledtr
    mgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddmt
    cvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcfin
    nynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6qaoE (E:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoE (E:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsfkspliifsd
    cdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledtr
    mgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddmt
    cvkeeifgpvmsilsfdteaevlerandtlaagvftrdiqrahrvvaelqagtcfinnyn
    vspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6qaoF (F:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoF (F:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsfggkspliif
    sdcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplled
    trmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrdd
    mtcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcf
    innynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6qaoG (G:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoG (G:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsftkspliifs
    dcdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledt
    rmgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddm
    tcvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcfi
    nnynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6qaoH (H:)
    mgsshhhhhhsqdpmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcs
    gekevnlavqnakaafkiwsqksgmercrilleaariireredeiatmecinngksifea
    rldidiswqcleyyaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswk
    sapalacgnamvfkpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdva
    kvsftgsvptgmkimemsakgikpvtlelggkspliifsdcdmnnavkgalmanfltqgq
    vccngtrvfvqkeildkfteevvkqtqrikigdplledtrmgplinrphlervlgfvkva
    keqgakvlcggdiyvpedpklkdgyymrpcvltncrddmtcvkeeifgpvmsilsfdtea
    evlerandttfglaagvftrdiqrahrvvaelqagtcfinnynvspvelpfggykksgfg
    rengrvtieyysqlktvcvemgdvesaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6qaoH (H:)
    pmstgtfvvsqplnyrggarvepadasgtekafepatgrviatftcsgekevnlavqnak
    aafkiwsqksgmercrilleaariireredeiatmecinngksifearldidiswqcley
    yaglaasmagehiqlpggsfgytrreplgvcvgigawnypfqiaswksapalacgnamvf
    kpspftpvsalllaeiyseagvppglfnvvqggaatgqflcqhpdvakvsfkspliifsd
    cdmnnavkgalmanfltqgqvccngtrvfvqkeildkfteevvkqtqrikigdplledtr
    mgplinrphlervlgfvkvakeqgakvlcggdiyvpedpklkdgyymrpcvltncrddmt
    cvkeeifgpvmsilsfdteaevlerandttfglaagvftrdiqrahrvvaelqagtcfin
    nynvspvelpfggykksgfgrengrvtieyysqlktvcvemgdvesaf